PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G169700.1.p
Common NameSb06g024510, SORBIDRAFT_06g024510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 379aa    MW: 40073.3 Da    PI: 8.6004
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G169700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.36.5e-123277146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                          +g WT+eEd  l++ v+ +G+++W++I ++  + Rt+k+c++rw +
  Sobic.006G169700.1.p 32 KGHWTAEEDAVLLEHVRVHGPRDWSSIRSKGFLPRTGKSCRLRWVN 77
                          789***********************97763367**********87 PP

2Myb_DNA-binding414.4e-1388128345
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           ++++eE+   +++ +q+G++ W++I+ +++ gRt++++k++w 
  Sobic.006G169700.1.p  88 KFSAEEERVVLELQAQFGNK-WARISTYLP-GRTDNDVKNFWS 128
                           79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.7422783IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-192980IPR009057Homeodomain-like
SMARTSM007173.1E-113181IPR001005SANT/Myb domain
SuperFamilySSF466893.07E-2731127IPR009057Homeodomain-like
PfamPF139212.1E-113585No hitNo description
CDDcd001678.76E-123579No hitNo description
Gene3DG3DSA:1.10.10.601.2E-1781133IPR009057Homeodomain-like
PROSITE profilePS5129417.38884135IPR017930Myb domain
SMARTSM007171.3E-1185133IPR001005SANT/Myb domain
PfamPF002492.4E-1188128IPR001005SANT/Myb domain
CDDcd001674.99E-1088127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MARAPGGARR RGGGGGSGRR DVAAGGGEAV RKGHWTAEED AVLLEHVRVH GPRDWSSIRS  60
KGFLPRTGKS CRLRWVNKLR PDLKTGCKFS AEEERVVLEL QAQFGNKWAR ISTYLPGRTD  120
NDVKNFWSTR QKRLARLLGT PLRGRSSRSR NRSGSAKAQA PVASSLEPRP AAVVPCLDQV  180
PLEGSSSGVH PCRAAIPFMD AQRVPLEGSS SGVHPCSAGT PFMDAHNAAL APYDWAGSGL  240
VSFGGALPLA SDSHACSSSN AAALPPLLPF DQPPYPLLDF PGLSAAGWNM APAGFANAGG  300
AMDHLAYQEL LPVTQPAPMM LPFFGTEYPH GGVKTELPDA APDNFFDDLP PDMFDSLDQP  360
PPPPPPPPLS PPATSSGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-24321334103C-Myb DNA-Binding Domain
1mse_C2e-24321334103C-Myb DNA-Binding Domain
1gv2_A2e-24321334103MYB PROTO-ONCOGENE PROTEIN
1a5j_A2e-24321337106B-MYB
1h8a_C4e-243213327126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0994153e-59AF099415.1 Zea mays clone ZmMYBIP102 R2R3MYB-domain protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002446896.10.0hypothetical protein SORBIDRAFT_06g024510
TrEMBLC5YDG50.0C5YDG5_SORBI; Putative uncharacterized protein Sb06g024510
STRINGSb06g024510.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.12e-62MYB family protein